APrEST92133-100ul, PrEST Antigen UPF3A Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen UPF3A, Gene description: UPF3 regulator of nonsense transcripts homolog A (yeast), Alternative Gene Names: HUPF3A, RENT3A, UPF3, Antigen sequence: FLETYCVEEEKTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLEKQR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen UPF3A, Gene description: UPF3 regulator of nonsense transcripts homolog A (yeast), Alternative Gene Names: HUPF3A, RENT3A, UPF3, Antigen sequence: FLETYCVEEEKTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLEKQR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|