APrEST92127-100ul, PrEST Antigen SCAPER Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SCAPER, Gene description: S-phase cyclin A-associated protein in the ER, Alternative Gene Names: Zfp291, ZNF291, Antigen sequence: KVKAHHTGSTASSEITPAQSCPPMTVQKASRKNERKDAEGWETVQRGRPIRSRSTAVMPKVSLATEATRSKDDSDKENVCLLPDESIQKGQFVGDGTSNTIESHPKDSLHSCDHPLA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SCAPER, Gene description: S-phase cyclin A-associated protein in the ER, Alternative Gene Names: Zfp291, ZNF291, Antigen sequence: KVKAHHTGSTASSEITPAQSCPPMTVQKASRKNERKDAEGWETVQRGRPIRSRSTAVMPKVSLATEATRSKDDSDKENVCLLPDESIQKGQFVGDGTSNTIESHPKDSLHSCDHPLA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|