APrEST92004-100ul, PrEST Antigen SOHLH1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SOHLH1, Gene description: spermatogenesis and oogenesis specific basic helix-loop-helix 1, Alternative Gene Names: bA100C15.3, bHLHe80, C9orf157, NOHLH, SPATA27, TEB2, Antigen sequence: PWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLCQVRGGLPPFSEPSSLVPWPPGRSLPKAVRP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SOHLH1, Gene description: spermatogenesis and oogenesis specific basic helix-loop-helix 1, Alternative Gene Names: bA100C15.3, bHLHe80, C9orf157, NOHLH, SPATA27, TEB2, Antigen sequence: PWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLCQVRGGLPPFSEPSSLVPWPPGRSLPKAVRP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|