APrEST91953-100ul, PrEST Antigen SEL1L3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SEL1L3, Gene description: sel-1 suppressor of lin-12-like 3 (C. elegans), Alternative Gene Names: KIAA0746, Antigen sequence: ERCAEVQEIVSVYASAAKHGGERQEACHLHNSYLDLQRRYGRPSMCRAFPWEKELKDKHPSLFQALLEMDLLTVPRNQNESVSEIGGKIFEKAVKRLSSIDGL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SEL1L3, Gene description: sel-1 suppressor of lin-12-like 3 (C. elegans), Alternative Gene Names: KIAA0746, Antigen sequence: ERCAEVQEIVSVYASAAKHGGERQEACHLHNSYLDLQRRYGRPSMCRAFPWEKELKDKHPSLFQALLEMDLLTVPRNQNESVSEIGGKIFEKAVKRLSSIDGL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|