APrEST91906-100ul, PrEST Antigen ACAP3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ACAP3, Gene description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 3, Alternative Gene Names: CENTB5, KIAA1716, Antigen sequence: LRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKGESVL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ACAP3, Gene description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 3, Alternative Gene Names: CENTB5, KIAA1716, Antigen sequence: LRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKGESVL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|