Limba
|
APrEST91850-100ul, PrEST Antigen SOCS4 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SOCS4, Gene description: suppressor of cytokine signaling 4, Alternative Gene Names: SOCS7, Antigen sequence: GYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SOCS4, Gene description: suppressor of cytokine signaling 4, Alternative Gene Names: SOCS7, Antigen sequence: GYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|