APrEST91847-100ul, PrEST Antigen SEC13 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SEC13, Gene description: SEC13 homolog, nuclear pore and COPII coat complex component, Alternative Gene Names: D3S1231E, npp-20, SEC13L1, SEC13R, Antigen sequence: IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SEC13, Gene description: SEC13 homolog, nuclear pore and COPII coat complex component, Alternative Gene Names: D3S1231E, npp-20, SEC13L1, SEC13R, Antigen sequence: IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|