Limba
|
APrEST91561-100ul, PrEST Antigen RGS12 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RGS12, Gene description: regulator of G-protein signaling 12, Antigen sequence: VFMVDPDLFNHKIHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFHQE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen RGS12, Gene description: regulator of G-protein signaling 12, Antigen sequence: VFMVDPDLFNHKIHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFHQE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|