Limba
|
APrEST91439-100ul, PrEST Antigen DOCK1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen DOCK1, Gene description: dedicator of cytokinesis 1, Alternative Gene Names: ced5, DOCK180, Antigen sequence: VRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen DOCK1, Gene description: dedicator of cytokinesis 1, Alternative Gene Names: ced5, DOCK180, Antigen sequence: VRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|