APrEST91420-100ul, PrEST Antigen TSPEAR Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TSPEAR, Gene description: thrombospondin-type laminin G domain and EAR repeats, Alternative Gene Names: C21orf29, DFNB98, MGC11251, TSP-EAR, Antigen sequence: KGQEFSVIYKWSHRKLKFTPYQSIATHSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFLVVANTFNGTST, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TSPEAR, Gene description: thrombospondin-type laminin G domain and EAR repeats, Alternative Gene Names: C21orf29, DFNB98, MGC11251, TSP-EAR, Antigen sequence: KGQEFSVIYKWSHRKLKFTPYQSIATHSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFLVVANTFNGTST, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|