Limba
|
APrEST91379-100ul, PrEST Antigen INCA1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen INCA1, Gene description: inhibitor of CDK, cyclin A1 interacting protein 1, Antigen sequence: LEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen INCA1, Gene description: inhibitor of CDK, cyclin A1 interacting protein 1, Antigen sequence: LEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|