APrEST91360-100ul, PrEST Antigen CABLES2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CABLES2, Gene description: Cdk5 and Abl enzyme substrate 2, Alternative Gene Names: C20orf150, dJ908M14.2, ik3-2, Antigen sequence: AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CABLES2, Gene description: Cdk5 and Abl enzyme substrate 2, Alternative Gene Names: C20orf150, dJ908M14.2, ik3-2, Antigen sequence: AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|