APrEST91264-100ul, PrEST Antigen ZBTB10 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ZBTB10, Gene description: zinc finger and BTB domain containing 10, Alternative Gene Names: FLJ12752, RINZF, Antigen sequence: AGEGETVQHFPLARPKSLMQKLQCSFQTSWLKDFPWLRYSKDTGLMSCGWCQKTPADGGSVDLPPVGHDELSRGTRNYKKTLLLRHHVSTEHKLHEAN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ZBTB10, Gene description: zinc finger and BTB domain containing 10, Alternative Gene Names: FLJ12752, RINZF, Antigen sequence: AGEGETVQHFPLARPKSLMQKLQCSFQTSWLKDFPWLRYSKDTGLMSCGWCQKTPADGGSVDLPPVGHDELSRGTRNYKKTLLLRHHVSTEHKLHEAN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|