APrEST91146-100ul, PrEST Antigen ADAMTS7 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ADAMTS7, Gene description: ADAM metallopeptidase with thrombospondin type 1 motif, 7, Alternative Gene Names: ADAM-TS7, DKFZp434H204, Antigen sequence: WDLQTVAVWGTFLPTTLTGLGHTPEPALNPGPKGQPESLSPEVPLSSRLLSM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ADAMTS7, Gene description: ADAM metallopeptidase with thrombospondin type 1 motif, 7, Alternative Gene Names: ADAM-TS7, DKFZp434H204, Antigen sequence: WDLQTVAVWGTFLPTTLTGLGHTPEPALNPGPKGQPESLSPEVPLSSRLLSM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|