Limba
|
APrEST91107-100ul, PrEST Antigen TOB1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TOB1, Gene description: transducer of ERBB2, 1, Alternative Gene Names: TOB, TROB, TROB1, Antigen sequence: STKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TOB1, Gene description: transducer of ERBB2, 1, Alternative Gene Names: TOB, TROB, TROB1, Antigen sequence: STKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|