APrEST91086-100ul, PrEST Antigen ST14 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ST14, Gene description: suppression of tumorigenicity 14 (colon carcinoma), Alternative Gene Names: HAI, MT-SP1, PRSS14, SNC19, TMPRSS14, Antigen sequence: VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ST14, Gene description: suppression of tumorigenicity 14 (colon carcinoma), Alternative Gene Names: HAI, MT-SP1, PRSS14, SNC19, TMPRSS14, Antigen sequence: VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|