APrEST91048-100ul, PrEST Antigen HACE1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen HACE1, Gene description: HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1, Alternative Gene Names: KIAA1320, Antigen sequence: PVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen HACE1, Gene description: HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1, Alternative Gene Names: KIAA1320, Antigen sequence: PVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|