Limba
|
APrEST90891-100ul, PrEST Antigen ZCWPW2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ZCWPW2, Gene description: zinc finger, CW type with PWWP domain 2, Alternative Gene Names: ZCW2, Antigen sequence: KLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIEFLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ZCWPW2, Gene description: zinc finger, CW type with PWWP domain 2, Alternative Gene Names: ZCW2, Antigen sequence: KLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIEFLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|