APrEST90346-100ul, PrEST Antigen GAREM2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen GAREM2, Gene description: GRB2 associated regulator of MAPK1 subtype 2, Alternative Gene Names: FAM59B, FLJ00375, KIAA2038, Antigen sequence: REGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen GAREM2, Gene description: GRB2 associated regulator of MAPK1 subtype 2, Alternative Gene Names: FAM59B, FLJ00375, KIAA2038, Antigen sequence: REGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|