APrEST90242-100ul, PrEST Antigen POT1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen POT1, Gene description: protection of telomeres 1, Alternative Gene Names: DKFZp586D211, hPot1, Antigen sequence: LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen POT1, Gene description: protection of telomeres 1, Alternative Gene Names: DKFZp586D211, hPot1, Antigen sequence: LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|