APrEST90217-100ul, PrEST Antigen ING3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ING3, Gene description: inhibitor of growth family, member 3, Alternative Gene Names: Eaf4, FLJ20089, MEAF4, p47ING3, Antigen sequence: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ING3, Gene description: inhibitor of growth family, member 3, Alternative Gene Names: Eaf4, FLJ20089, MEAF4, p47ING3, Antigen sequence: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|