Limba
|
APrEST90089-100ul, PrEST Antigen SFMBT1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SFMBT1, Gene description: Scm-like with four mbt domains 1, Alternative Gene Names: DKFZp434L243, RU1, SFMBT, Antigen sequence: YTHYYGKKKNKRIGRPPGGHSNLACALKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SFMBT1, Gene description: Scm-like with four mbt domains 1, Alternative Gene Names: DKFZp434L243, RU1, SFMBT, Antigen sequence: YTHYYGKKKNKRIGRPPGGHSNLACALKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|