APrEST89894-100ul, PrEST Antigen CNNM2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CNNM2, Gene description: cyclin and CBS domain divalent metal cation transport mediator 2, Alternative Gene Names: ACDP2, Antigen sequence: AVGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen CNNM2, Gene description: cyclin and CBS domain divalent metal cation transport mediator 2, Alternative Gene Names: ACDP2, Antigen sequence: AVGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|