APrEST89874-100ul, PrEST Antigen EYA2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen EYA2, Gene description: EYA transcriptional coactivator and phosphatase 2, Alternative Gene Names: EAB1, Antigen sequence: MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen EYA2, Gene description: EYA transcriptional coactivator and phosphatase 2, Alternative Gene Names: EAB1, Antigen sequence: MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|