APrEST89833-100ul, PrEST Antigen SETMAR Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SETMAR, Gene description: SET domain and mariner transposase fusion gene, Alternative Gene Names: metnase, Antigen sequence: ELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SETMAR, Gene description: SET domain and mariner transposase fusion gene, Alternative Gene Names: metnase, Antigen sequence: ELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|