APrEST89802-100ul, PrEST Antigen CAD Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CAD, Gene description: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase, Antigen sequence: VLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CAD, Gene description: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase, Antigen sequence: VLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|