Limba
    
                  |
 
                APrEST89789-100ul, PrEST Antigen ARGLU1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ARGLU1, Gene description: arginine and glutamate rich 1, Alternative Gene Names: FLJ10154, Antigen sequence: RSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) | 
|---|---|
| Description | PrEST Antigen ARGLU1, Gene description: arginine and glutamate rich 1, Alternative Gene Names: FLJ10154, Antigen sequence: RSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. 
 |