APrEST89787-100ul, PrEST Antigen RCBTB1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RCBTB1, Gene description: regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1, Alternative Gene Names: CLLD7, CLLL7, FLJ10716, Antigen sequence: RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen RCBTB1, Gene description: regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1, Alternative Gene Names: CLLD7, CLLL7, FLJ10716, Antigen sequence: RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|