APrEST89755-100ul, PrEST Antigen CAND1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CAND1, Gene description: cullin-associated and neddylation-dissociated 1, Alternative Gene Names: DKFZp434M1414, KIAA0829, TIP120, TIP120A, Antigen sequence: DALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CAND1, Gene description: cullin-associated and neddylation-dissociated 1, Alternative Gene Names: DKFZp434M1414, KIAA0829, TIP120, TIP120A, Antigen sequence: DALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|