APrEST89600-100ul, PrEST Antigen NCKIPSD Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen NCKIPSD, Gene description: NCK interacting protein with SH3 domain, Alternative Gene Names: AF3P21, DIP1, ORF1, SPIN90, WASLBP, WISH, Antigen sequence: RKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen NCKIPSD, Gene description: NCK interacting protein with SH3 domain, Alternative Gene Names: AF3P21, DIP1, ORF1, SPIN90, WASLBP, WISH, Antigen sequence: RKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|