APrEST89583-100ul, PrEST Antigen COG8 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen COG8, Gene description: component of oligomeric golgi complex 8, Alternative Gene Names: DOR1, FLJ22315, Antigen sequence: AKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen COG8, Gene description: component of oligomeric golgi complex 8, Alternative Gene Names: DOR1, FLJ22315, Antigen sequence: AKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|