APrEST89397-100ul, PrEST Antigen LGSN Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen LGSN, Gene description: lengsin, lens protein with glutamine synthetase domain, Alternative Gene Names: GLULD1, LGS, Antigen sequence: VSRSKTIPAHFFQEKVSHGVCMPRGYLEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPLLTSPRY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen LGSN, Gene description: lengsin, lens protein with glutamine synthetase domain, Alternative Gene Names: GLULD1, LGS, Antigen sequence: VSRSKTIPAHFFQEKVSHGVCMPRGYLEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPLLTSPRY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|