APrEST89304-100ul, PrEST Antigen CC2D1B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CC2D1B, Gene description: coiled-coil and C2 domain containing 1B, Alternative Gene Names: KIAA1836, Antigen sequence: RIGKRFGAVLEALEKGQPVDLSAMPPAPEDLKPQQASQAPTAPSVIPPAVERVQPVMAPDVPATPVAPTESQTVLDALQQRLNKYREAGIQARS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen CC2D1B, Gene description: coiled-coil and C2 domain containing 1B, Alternative Gene Names: KIAA1836, Antigen sequence: RIGKRFGAVLEALEKGQPVDLSAMPPAPEDLKPQQASQAPTAPSVIPPAVERVQPVMAPDVPATPVAPTESQTVLDALQQRLNKYREAGIQARS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|