APrEST89262-100ul, PrEST Antigen ADAMTS9 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ADAMTS9, Gene description: ADAM metallopeptidase with thrombospondin type 1 motif, 9, Alternative Gene Names: KIAA1312, Antigen sequence: KVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ADAMTS9, Gene description: ADAM metallopeptidase with thrombospondin type 1 motif, 9, Alternative Gene Names: KIAA1312, Antigen sequence: KVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|