Limba
|
APrEST89180-100ul, PrEST Antigen LIMS1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen LIMS1, Gene description: LIM and senescent cell antigen-like domains 1, Alternative Gene Names: PINCH, PINCH1, Antigen sequence: MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen LIMS1, Gene description: LIM and senescent cell antigen-like domains 1, Alternative Gene Names: PINCH, PINCH1, Antigen sequence: MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|