Limba
|
APrEST89109-100ul, PrEST Antigen STAT5A Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen STAT5A, Gene description: signal transducer and activator of transcription 5A, Alternative Gene Names: MGF, STAT5, Antigen sequence: KTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen STAT5A, Gene description: signal transducer and activator of transcription 5A, Alternative Gene Names: MGF, STAT5, Antigen sequence: KTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|