APrEST88725-100ul, PrEST Antigen SPECC1L Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SPECC1L, Gene description: sperm antigen with calponin homology and coiled-coil domains 1-like, Alternative Gene Names: CYTSA, KIAA0376, Antigen sequence: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SPECC1L, Gene description: sperm antigen with calponin homology and coiled-coil domains 1-like, Alternative Gene Names: CYTSA, KIAA0376, Antigen sequence: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|