APrEST88687-100ul, PrEST Antigen MKI67IP Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen NIFK, Gene description: nucleolar protein interacting with the FHA domain of MKI67, Alternative Gene Names: NIFK, hNIFK, Nopp34, Antigen sequence: IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen NIFK, Gene description: nucleolar protein interacting with the FHA domain of MKI67, Alternative Gene Names: NIFK, hNIFK, Nopp34, Antigen sequence: IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|