Limba
|
APrEST88528-100ul, PrEST Antigen ASB18 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ASB18, Gene description: ankyrin repeat and SOCS box containing 18, Antigen sequence: DYLHDYPLNSDLVKRLKSALDAKDEERVRDLICTEITPVDAVIELANDDWMKDPSAQLPTGMLLGDLD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ASB18, Gene description: ankyrin repeat and SOCS box containing 18, Antigen sequence: DYLHDYPLNSDLVKRLKSALDAKDEERVRDLICTEITPVDAVIELANDDWMKDPSAQLPTGMLLGDLD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|