APrEST88494-100ul, PrEST Antigen SCLT1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SCLT1, Gene description: sodium channel and clathrin linker 1, Alternative Gene Names: FLJ30655, hCAP-1A, Antigen sequence: STMEHEFSIKERGFEVQLREMEDSNRNSIVELRHLLATQQKAANRWKEETKKLTESAEIRINNLKSELSRQKLHTQELLSQLEMANEK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SCLT1, Gene description: sodium channel and clathrin linker 1, Alternative Gene Names: FLJ30655, hCAP-1A, Antigen sequence: STMEHEFSIKERGFEVQLREMEDSNRNSIVELRHLLATQQKAANRWKEETKKLTESAEIRINNLKSELSRQKLHTQELLSQLEMANEK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|