Limba
|
APrEST88471-100ul, PrEST Antigen FGD2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FGD2, Gene description: FYVE, RhoGEF and PH domain containing 2, Alternative Gene Names: ZFYVE4, Antigen sequence: RAHTSIPLLGYQVTVGPQGDPRVFQLQQSGQLYTFKAETEELKGRWVKAMERAASGWSPSWPNDGDLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen FGD2, Gene description: FYVE, RhoGEF and PH domain containing 2, Alternative Gene Names: ZFYVE4, Antigen sequence: RAHTSIPLLGYQVTVGPQGDPRVFQLQQSGQLYTFKAETEELKGRWVKAMERAASGWSPSWPNDGDLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|