APrEST88431-100ul, PrEST Antigen IGFN1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen IGFN1, Gene description: immunoglobulin-like and fibronectin type III domain containing 1, Alternative Gene Names: DKFZp434B1231, EEF1A2BP1, Antigen sequence: AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIYTNRFTLLGILPGHEYHFRVVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen IGFN1, Gene description: immunoglobulin-like and fibronectin type III domain containing 1, Alternative Gene Names: DKFZp434B1231, EEF1A2BP1, Antigen sequence: AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIYTNRFTLLGILPGHEYHFRVVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|