APrEST88413-100ul, PrEST Antigen IKBKAP Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen IKBKAP, Gene description: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein, Alternative Gene Names: DYS, ELP1, IKAP, IKI3, TOT1, Antigen sequence: RLHVLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVPPPMCTYQLLFPHPVNQVTFLAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen IKBKAP, Gene description: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein, Alternative Gene Names: DYS, ELP1, IKAP, IKI3, TOT1, Antigen sequence: RLHVLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVPPPMCTYQLLFPHPVNQVTFLAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|