Limba
|
APrEST88303-100ul, PrEST Antigen PYCARD Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen PYCARD, Gene description: PYD and CARD domain containing, Alternative Gene Names: ASC, CARD5, TMS-1, Antigen sequence: ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen PYCARD, Gene description: PYD and CARD domain containing, Alternative Gene Names: ASC, CARD5, TMS-1, Antigen sequence: ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|