APrEST88292-100ul, PrEST Antigen DCAF1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen DCAF1, Gene description: DDB1 and CUL4 associated factor 1, Alternative Gene Names: DCAF1, KIAA0800, MGC102804, Antigen sequence: IAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMNISGVFHPNGLEVIINTEIWD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen DCAF1, Gene description: DDB1 and CUL4 associated factor 1, Alternative Gene Names: DCAF1, KIAA0800, MGC102804, Antigen sequence: IAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMNISGVFHPNGLEVIINTEIWD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|