APrEST88280-100ul, PrEST Antigen SEMA4A Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SEMA4A, Gene description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A, Alternative Gene Names: CORD10, FLJ12287, SEMAB, SemB, Antigen sequence: SGVEYTRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SEMA4A, Gene description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A, Alternative Gene Names: CORD10, FLJ12287, SEMAB, SemB, Antigen sequence: SGVEYTRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|