Limba
|
APrEST88214-100ul, PrEST Antigen MLC1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen MLC1, Gene description: megalencephalic leukoencephalopathy with subcortical cysts 1, Alternative Gene Names: KIAA0027, LVM, MLC, VL, Antigen sequence: NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen MLC1, Gene description: megalencephalic leukoencephalopathy with subcortical cysts 1, Alternative Gene Names: KIAA0027, LVM, MLC, VL, Antigen sequence: NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|