APrEST88108-100ul, PrEST Antigen SPICE1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SPICE1, Gene description: spindle and centriole associated protein 1, Alternative Gene Names: CCDC52, SPICE, Antigen sequence: DEQLISLTHAIKNCPVINNRQEIQASESGATGRRVMDSPERPVVNANVSVPLMFREEVAEFPQEELPVKLSQVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SPICE1, Gene description: spindle and centriole associated protein 1, Alternative Gene Names: CCDC52, SPICE, Antigen sequence: DEQLISLTHAIKNCPVINNRQEIQASESGATGRRVMDSPERPVVNANVSVPLMFREEVAEFPQEELPVKLSQVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|