Limba
|
APrEST88053-100ul, PrEST Antigen MARCO Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen MARCO, Gene description: macrophage receptor with collagenous structure, Alternative Gene Names: SCARA2, Antigen sequence: LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen MARCO, Gene description: macrophage receptor with collagenous structure, Alternative Gene Names: SCARA2, Antigen sequence: LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|