APrEST88041-100ul, PrEST Antigen ITGA2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ITGA2, Gene description: integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor), Alternative Gene Names: CD49B, Antigen sequence: ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ITGA2, Gene description: integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor), Alternative Gene Names: CD49B, Antigen sequence: ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|